4.78 Rating by CuteStat

contagerencianet.com.br is 1 decade 3 years old. It is a domain having com.br extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, contagerencianet.com.br is SAFE to browse.

PageSpeed Score
91
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 90
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.31.85.83

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
contagerencianet.com.br | 522: Connection timed out

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 3
H3 Headings: 3 H4 Headings: Not Applicable
H5 Headings: 2 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.31.85.83)

Welcome to nginx!

- kurort-zu-hause.de
Not Applicable $ 8.95


En Yeni Dekor Mobilya Modelleri

- dekormobilyam3.com

Mobilya Dekoratif modellerinin en iyileri

Not Applicable $ 8.95

News Travel Blog -

- utssa.com
Not Applicable $ 8.95

Wrinkle Miracle - Discover a $5 Solution to a Wrinkle Free Face

- skinimpracticalsympathy.review
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 522 Origin Connection Time-out
Date: Tue, 10 Dec 2019 02:37:56 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: no-store, no-cache
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
CF-Cache-Status: DYNAMIC
Expires: Thu, 01 Jan 1970 00:00:01 GMT
Pragma: no-cache
Server: cloudflare
CF-RAY: 542bd6d80d03937c-SJC

Domain Information

Domain Registrar: Gerencianet - Departamento Financeiro
Registration Date: Nov 30, 2010, 12:00 AM 1 decade 3 years 5 months ago
Expiration Date: Nov 30, 2020, 12:00 AM 3 years 5 months 2 weeks ago
Domain Status:
published

Domain Nameserver Information

Host IP Address Country
zelda.ns.cloudflare.com 108.162.192.242 United States of America United States of America
scott.ns.cloudflare.com 108.162.193.230 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
contagerencianet.com.br A 294 IP: 104.31.84.83
contagerencianet.com.br A 294 IP: 104.31.85.83
contagerencianet.com.br NS 86400 Target: scott.ns.cloudflare.com
contagerencianet.com.br NS 86400 Target: zelda.ns.cloudflare.com
contagerencianet.com.br SOA 3600 MNAME: scott.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2031155130
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
contagerencianet.com.br MX 300 Priority: 10
Target: multiplemail.gerencianet.com.br
contagerencianet.com.br AAAA 300 IPV6: 2606:4700:30::681f:5553
contagerencianet.com.br AAAA 300 IPV6: 2606:4700:30::681f:5453

Full WHOIS Lookup

% Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2019-12-09T23:38:19-03:00

domain: contagerencianet.com.br
owner: GERENCIANET PAGAMENTOS DO BRASIL LTDA
owner-c: DEAES
admin-c: DEAES
tech-c: DEAES
billing-c: GEDFI5
nserver: scott.ns.cloudflare.com
nsstat: 20191207 AA
nslastaa: 20191207
nserver: zelda.ns.cloudflare.com
nsstat: 20191207 AA
nslastaa: 20191207
saci: yes
created: 20101130 #7630158
changed: 20191102
expires: 20201130
status: published

nic-hdl-br: DEAES
person: Departamento Administrativo Estratégico
created: 20120404
changed: 20190205

nic-hdl-br: GEDFI5
person: Gerencianet - Departamento Financeiro
created: 20170621
changed: 20170621

% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to cert@cert.br
% and mail-abuse@cert.br
%
% whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, contact handle (ID), CIDR block, IP and ASN.