Web Analysis for Contagerencianet - contagerencianet.com.br
4.78
Rating by CuteStat
contagerencianet.com.br is 1 decade 3 years old. It is a domain having com.br extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, contagerencianet.com.br is SAFE to browse.
PageSpeed Score
91
Siteadvisor Rating
No Risk Issues
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 90 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 3 |
H3 Headings: | 3 | H4 Headings: | Not Applicable |
H5 Headings: | 2 | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 104.31.85.83)
New England Bears, Inc. - Baby Bears for Sale | Purchase Live Baby Bea
- buybears.org
4,869,133
$
240.00
En Yeni Dekor Mobilya Modelleri
- dekormobilyam3.com
Mobilya Dekoratif modellerinin en iyileri
Not Applicable
$
8.95
Wrinkle Miracle - Discover a $5 Solution to a Wrinkle Free Face
- skinimpracticalsympathy.review
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 522 Origin Connection Time-out
Date: Tue, 10 Dec 2019 02:37:56 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: no-store, no-cache
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
CF-Cache-Status: DYNAMIC
Expires: Thu, 01 Jan 1970 00:00:01 GMT
Pragma: no-cache
Server: cloudflare
CF-RAY: 542bd6d80d03937c-SJC
Date: Tue, 10 Dec 2019 02:37:56 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: no-store, no-cache
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
CF-Cache-Status: DYNAMIC
Expires: Thu, 01 Jan 1970 00:00:01 GMT
Pragma: no-cache
Server: cloudflare
CF-RAY: 542bd6d80d03937c-SJC
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
zelda.ns.cloudflare.com | 108.162.192.242 | United States of America | |
scott.ns.cloudflare.com | 108.162.193.230 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
contagerencianet.com.br | A | 294 |
IP: 104.31.84.83 |
contagerencianet.com.br | A | 294 |
IP: 104.31.85.83 |
contagerencianet.com.br | NS | 86400 |
Target: scott.ns.cloudflare.com |
contagerencianet.com.br | NS | 86400 |
Target: zelda.ns.cloudflare.com |
contagerencianet.com.br | SOA | 3600 |
MNAME: scott.ns.cloudflare.com RNAME: dns.cloudflare.com Serial: 2031155130 Refresh: 10000 Retry: 2400 Expire: 604800 Minimum TTL: 3600 |
contagerencianet.com.br | MX | 300 |
Priority: 10 Target: multiplemail.gerencianet.com.br |
contagerencianet.com.br | AAAA | 300 |
IPV6: 2606:4700:30::681f:5553 |
contagerencianet.com.br | AAAA | 300 |
IPV6: 2606:4700:30::681f:5453 |
Full WHOIS Lookup
% Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2019-12-09T23:38:19-03:00
domain: contagerencianet.com.br
owner: GERENCIANET PAGAMENTOS DO BRASIL LTDA
owner-c: DEAES
admin-c: DEAES
tech-c: DEAES
billing-c: GEDFI5
nserver: scott.ns.cloudflare.com
nsstat: 20191207 AA
nslastaa: 20191207
nserver: zelda.ns.cloudflare.com
nsstat: 20191207 AA
nslastaa: 20191207
saci: yes
created: 20101130 #7630158
changed: 20191102
expires: 20201130
status: published
nic-hdl-br: DEAES
person: Departamento Administrativo Estratégico
created: 20120404
changed: 20190205
nic-hdl-br: GEDFI5
person: Gerencianet - Departamento Financeiro
created: 20170621
changed: 20170621
% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to cert@cert.br
% and mail-abuse@cert.br
%
% whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, contact handle (ID), CIDR block, IP and ASN.
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2019-12-09T23:38:19-03:00
domain: contagerencianet.com.br
owner: GERENCIANET PAGAMENTOS DO BRASIL LTDA
owner-c: DEAES
admin-c: DEAES
tech-c: DEAES
billing-c: GEDFI5
nserver: scott.ns.cloudflare.com
nsstat: 20191207 AA
nslastaa: 20191207
nserver: zelda.ns.cloudflare.com
nsstat: 20191207 AA
nslastaa: 20191207
saci: yes
created: 20101130 #7630158
changed: 20191102
expires: 20201130
status: published
nic-hdl-br: DEAES
person: Departamento Administrativo Estratégico
created: 20120404
changed: 20190205
nic-hdl-br: GEDFI5
person: Gerencianet - Departamento Financeiro
created: 20170621
changed: 20170621
% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to cert@cert.br
% and mail-abuse@cert.br
%
% whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, contact handle (ID), CIDR block, IP and ASN.